PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0568s0044.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 339aa    MW: 37062 Da    PI: 5.894
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0568s0044.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18250284135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Bostr.0568s0044.2.p 250 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 284
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-1061338IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.82244280IPR000679Zinc finger, GATA-type
SMARTSM004011.5E-16244298IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.9E-14246307No hitNo description
Gene3DG3DSA:3.30.50.104.2E-15248282IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.92E-14249297No hitNo description
PfamPF003201.4E-16250284IPR000679Zinc finger, GATA-type
PROSITE patternPS003440250275IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEQAALKSSI RKEMAFKTTP PVYEEFLAVT TAQNGFSADD FSVDDLLDLS NDDVFADEET  60
DLKAQEQEMV RVSSEELNDD GDALRRSNDF SGCDDFGSLP TSELSVPADD LANLEWLSHF  120
VDDSFTEYSG PNLTGTPTEK PAWLTGDRKH PVTLATEESC FKSSVPAKAR SKRHRNGVKA  180
WSLGSSSSSG PSSSGSTSSS SSSGPSSPWF SGAELLEPMV TSERPPFPKK HKKRSAESPF  240
CSQLQPPRRC SHCGVQKTPQ WRAGPMGAKT LCNACGVRYK SGRLLPEYRP ACSPTFSSEL  300
HSNHHRKVME MRRKKEPTND NETGLNQLVQ SPQAVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1364500.0AY136450.1 Arabidopsis thaliana GATA-binding transcription factor-like protein (At5g66320) mRNA, complete cds.
GenBankBT0103670.0BT010367.1 Arabidopsis thaliana At5g66320 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201433.10.0GATA transcription factor 5
RefseqNP_975002.10.0GATA transcription factor 5
SwissprotQ9FH570.0GATA5_ARATH; GATA transcription factor 5
TrEMBLD7MMY80.0D7MMY8_ARALL; Zinc finger family protein
STRINGAT5G66320.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.20.0GATA transcription factor 5